PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10011645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 226aa    MW: 24485.7 Da    PI: 6.496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10011645genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.61.1e-43511501100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp +qp+kf ++h++FGasn++k+l++lpee+r da+ss+vyeA ar+rdPvyG++g i++lq+q++ l+a+la+ +
  Lus10011645  51 PCAACKILRRRCADKCVLAPYFPPSQPAKFSIAHRVFGASNIIKFLQELPEEQRADAVSSMVYEATARIRDPVYGCAGAISHLQHQVNDLQAQLAKSQ 148
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  ++
  Lus10011645 149 AQ 150
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97350151IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4351148IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEFSEAKAAT TTGNSTPSST TTNSSTSPLL PPSPDSTSSP PPPPPVVIVS PCAACKILRR  60
RCADKCVLAP YFPPSQPAKF SIAHRVFGAS NIIKFLQELP EEQRADAVSS MVYEATARIR  120
DPVYGCAGAI SHLQHQVNDL QAQLAKSQAQ VLTMQAHQAH LMAQILCLEM GHHPSPPDTF  180
IVSNDSNSIP TQTYQKQQQH ENFSSCYADD TTQLLMGPLW EPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.14e-79lateral organ boundaries (LOB) domain protein
SwissprotQ9LQR03e-67LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7IKN34e-79G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGPOPTR_0008s04350.12e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-67LOB domain-containing protein 1